PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00297.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 150aa    MW: 17745.2 Da    PI: 9.6181
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00297.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761e-5471361129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv++yL+kk+++k+++l +v+ke+d+yk+ePwdL++  k+ + e++ewyfFs++dkky+tg+r+nratk+g+W
  Sme2.5_00297.1_g00005.1   7 VPPGFRFHPTDEELVDYYLRKKIASKRIDL-DVMKEIDLYKIEPWDLQElcKIGSeEQNEWYFFSHKDKKYPTGTRTNRATKAGFW 91 
                              69****************************.99**************954555552555*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk++++ k+ l+g++ktLvfykgrap+g+k+d +mheyrle
  Sme2.5_00297.1_g00005.1  92 KATGRDKAIYR-KHCLIGMRKTLVFYKGRAPNGQKSDYIMHEYRLE 136
                              ***********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-565142IPR003441NAC domain
PROSITE profilePS5100552.1497150IPR003441NAC domain
PfamPF023651.6E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MNSFTHVPPG FRFHPTDEEL VDYYLRKKIA SKRIDLDVMK EIDLYKIEPW DLQELCKIGS  60
EEQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YRKHCLIGMR KTLVFYKGRA  120
PNGQKSDYIM HEYRLETNDN GNSIQASLLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-49613514140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754471e-120HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755201e-120HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246148.11e-102PREDICTED: NAC domain-containing protein 7
RefseqXP_010325466.11e-102PREDICTED: NAC domain-containing protein 7
RefseqXP_015084020.11e-102PREDICTED: NAC domain-containing protein 7
RefseqXP_015084021.11e-102PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-94NAC7_ARATH; NAC domain-containing protein 7
TrEMBLK4CNS11e-102K4CNS1_SOLLC; Uncharacterized protein
STRINGSolyc08g079120.1.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.17e-96NAC 007